PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_11876A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 314aa    MW: 34130 Da    PI: 8.7337
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_11876AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding322.9e-10534130
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                               ++rWT+eE+  l+ +v+++G+g W+tI r 
  Oropetium_20150105_11876A  5 KQRWTAEEEAALKAGVAKHGPGKWRTILRD 34
                               79*************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.039151IPR017930Myb domain
SuperFamilySSF466896.36E-10250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-10456IPR009057Homeodomain-like
PfamPF002491.4E-6533IPR001005SANT/Myb domain
CDDcd116601.46E-15670No hitNo description
SuperFamilySSF467855.99E-15135209IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.109.4E-16136206IPR011991Winged helix-turn-helix DNA-binding domain
PROSITE profilePS5150422.835137205IPR005818Linker histone H1/H5, domain H15
SMARTSM005262.4E-9137200IPR005818Linker histone H1/H5, domain H15
PfamPF005381.1E-9142198IPR005818Linker histone H1/H5, domain H15
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006334Biological Processnucleosome assembly
GO:0000786Cellular Componentnucleosome
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGAPKQRWTA EEEAALKAGV AKHGPGKWRT ILRDPDFSAL LRLRSNVDLK VGGFALLPHR  60
IGGEDKWRNL SVTAGGYGSR EKARMALKKG RRPTKITDEP MALEEHNMDN VHNAVLDAQP  120
LAMVAEPLQL EDSPDKSVAR LDDLILEAIK NLKDALGSNK AAIAAYIEEQ YWPPADFQRL  180
LSAKLKALVS AGKLMKVNQK YRIAPTSPSL GRKSNKVYST EEMNGENNVK PLTKPQVDSE  240
LEKMRSMTKE EAAAFAAKAV AEAEVAIAEA EEAARVAEAA ETDAEAAKAF LEAVTATMKN  300
RNLASTVEQT PFS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969042.11e-135PREDICTED: single myb histone 1-like
SwissprotB4FT401e-124SMH2_MAIZE; Single myb histone 2
TrEMBLA0A0A9F8041e-140A0A0A9F804_ARUDO; Uncharacterized protein
STRINGSi002403m1e-135(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132438110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49950.34e-56telomere repeat binding factor 1